PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400004491
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 352aa    MW: 38139.9 Da    PI: 6.6927
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400004491genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.82.6e-17240274135
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                           C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  PGSC0003DMP400004491 240 CLHCASDKTPQWRTGPLGPKTLCNACGVRYKSGRL 274
                           99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169927.4E-796328IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.374234270IPR000679Zinc finger, GATA-type
SMARTSM004014.8E-15234284IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.1E-13236271IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.71E-14236297No hitNo description
CDDcd002021.53E-13239286No hitNo description
PROSITE patternPS003440240265IPR000679Zinc finger, GATA-type
PfamPF003203.1E-15240274IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MEASDLFVSG FFSHAGDEQI PNNINNNNNC NNFSVDDLLV IPKEDEVMAD AFFNNITGNS  60
TDSSTVTVVD SCNSSVSGGD GQFNGNLSGR SFTDAPFPNS ELCVPFDDLA ELEWLSNFVE  120
ESFSSDDVQN LQFIPVANIN SSTITTDSSS SATTFSTGPN SPPAFPTDTS VPGKARSKRS  180
RAAPCDWSSR LQLLLSPATS SSESNSISPP SANNTTFATA KATKAPSKKR ESVETPGRKC  240
LHCASDKTPQ WRTGPLGPKT LCNACGVRYK SGRLVPEYRP ASSPTFISAR HSNSHRKVLE  300
LRRQKDLQRH QAHHHQHQLL SQPTIFGVSN GGDEFLLHHH QNCGPNFRHL I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754420.0HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755150.0HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343049.20.0PREDICTED: GATA transcription factor 12-like
SwissprotP697816e-78GAT12_ARATH; GATA transcription factor 12
TrEMBLM0ZRF80.0M0ZRF8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000064910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19192363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-67GATA transcription factor 12
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]